PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv7_170190_qoni.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family NF-YA
Protein Properties Length: 284aa    MW: 31608.1 Da    PI: 9.3701
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv7_170190_qoni.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA105.16.1e-33134190158
           CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                         +ep+YVNaKQy++Il+RRq+Rakle+++kl +k+rkpylheSRh+hAl+R RgsgGrF
  Bv7_170190_qoni.t1 134 NEPIYVNAKQYHGILRRRQHRAKLEAQNKL-AKNRKPYLHESRHQHALKRVRGSGGRF 190
                         59****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.1E-36132193IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.026133193IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.6E-28135190IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.0E-24136158IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860138158IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.0E-24167190IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MGVPAQRYQG AKLLDFSLQD QDSCSTQSTG QSYTSSASFG ENDLHTQSMS FAQSGYNATF  60
RKQEDGEIQF PLSMGTQNYI IPPLQTDYNQ GFPHYAVTFP EQHFRSVIST DGPQALMMGI  120
MPARVPLPHD LSANEPIYVN AKQYHGILRR RQHRAKLEAQ NKLAKNRKPY LHESRHQHAL  180
KRVRGSGGRF LNTKRLQESK RAASTNEGHK VSGAISLHLA GKMSGSEVHQ QENYKEGTST  240
TSCSDVTRTS TSDDIYHPLE FRFSGYSSCF GEAPHGGGSR GNYI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-21134194262NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010685336.10.0PREDICTED: nuclear transcription factor Y subunit A-3
TrEMBLA0A0J8BXX00.0A0A0J8BXX0_BETVU; Uncharacterized protein
STRINGGLYMA07G04050.52e-69(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.14e-52nuclear factor Y, subunit A3